ARMCX1 Recombinant Protein Antigen

Images

 
There are currently no images for ARMCX1 Protein (NBP1-89145PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARMCX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARMCX1.

Source: E. coli

Amino Acid Sequence: DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARMCX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89145.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARMCX1 Recombinant Protein Antigen

  • ALEX1armadillo repeat-containing X-linked protein 1
  • ARM protein lost in epithelial cancers on chromosome X 1
  • arm protein lost in epithelial cancers, X chromosome, 1
  • armadillo repeat containing, X-linked 1
  • DKFZp686P06199
  • Protein ALEX1

Background

ARMCX1 encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89144
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-89142
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP1-90312
Species: Hu
Applications: IHC,  IHC-P
NBP2-46379
Species: Hu
Applications: IHC,  IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25502
Species: Ca, Hu, Mu, Rt, Ze
Applications: IHC,  IHC-P, WB
AF7179
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF1734
Species: Hu
Applications: IP, WB
NBP1-89145PEP
Species: Hu
Applications: AC

Publications for ARMCX1 Protein (NBP1-89145PEP) (0)

There are no publications for ARMCX1 Protein (NBP1-89145PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX1 Protein (NBP1-89145PEP) (0)

There are no reviews for ARMCX1 Protein (NBP1-89145PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARMCX1 Protein (NBP1-89145PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARMCX1 Products

Array NBP1-89145PEP

Blogs on ARMCX1

There are no specific blogs for ARMCX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARMCX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX1