Recombinant Human ARMCX1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARMCX1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 188-295 of Human ARMCX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARMCX1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
No additives

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARMCX1 Protein

  • ALEX1armadillo repeat-containing X-linked protein 1
  • ARM protein lost in epithelial cancers on chromosome X 1
  • arm protein lost in epithelial cancers, X chromosome, 1
  • armadillo repeat containing, X-linked 1
  • DKFZp686P06199
  • Protein ALEX1

Background

ARMCX1 - armadillo repeat containing, X-linked 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89144
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-89142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
NBP1-90642
Species: Hu
Applications: IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27152
Species: Mu
Applications: WB
AF7179
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
AF1734
Species: Hu
Applications: WB, IP
H00051309-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARMCX1 Partial Recombinant Protein (H00051309-Q01) (0)

There are no publications for ARMCX1 Partial Recombinant Protein (H00051309-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX1 Partial Recombinant Protein (H00051309-Q01) (0)

There are no reviews for ARMCX1 Partial Recombinant Protein (H00051309-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMCX1 Partial Recombinant Protein (H00051309-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARMCX1 Products

Bioinformatics Tool for ARMCX1 Partial Recombinant Protein (H00051309-Q01)

Discover related pathways, diseases and genes to ARMCX1 Partial Recombinant Protein (H00051309-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMCX1 Partial Recombinant Protein (H00051309-Q01)

Discover more about diseases related to ARMCX1 Partial Recombinant Protein (H00051309-Q01).
 

Pathways for ARMCX1 Partial Recombinant Protein (H00051309-Q01)

View related products by pathway.

PTMs for ARMCX1 Partial Recombinant Protein (H00051309-Q01)

Learn more about PTMs related to ARMCX1 Partial Recombinant Protein (H00051309-Q01).

Blogs on ARMCX1

There are no specific blogs for ARMCX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARMCX1 Antibody
NBP1-89145

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARMCX1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX1