Aquaporin 1/AQP1 Recombinant Protein Antigen

Images

 
There are currently no images for Aquaporin 1/AQP1 Protein (NBP1-84488PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aquaporin 1/AQP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AQP1.

Source: E. coli

Amino Acid Sequence: PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AQP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84488.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aquaporin 1/AQP1 Recombinant Protein Antigen

  • 28-kDa
  • AQP1
  • AQP-1
  • AQP-CHIP
  • aquaporin 1 (channel-forming integral protein, 28kDa)
  • aquaporin 1 (Colton blood group)
  • Aquaporin 1
  • Aquaporin-CHIP
  • CHIP28
  • CHIP2828kDa, CO blood group)
  • CO
  • MGC26324

Background

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-97927
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67247
Species: Hu
Applications: ICC/IF, WB
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC-Fr, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-30865
Species: Hu
Applications: IHC,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-91676
Species: Hu
Applications: IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-75440
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2030
Species: Hu
Applications: IHC, WB
7954-GM/CF
Species: Hu
Applications: BA

Publications for Aquaporin 1/AQP1 Protein (NBP1-84488PEP) (0)

There are no publications for Aquaporin 1/AQP1 Protein (NBP1-84488PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin 1/AQP1 Protein (NBP1-84488PEP) (0)

There are no reviews for Aquaporin 1/AQP1 Protein (NBP1-84488PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aquaporin 1/AQP1 Protein (NBP1-84488PEP). (Showing 1 - 1 of 1 FAQ).

  1. Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.
    • A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.

Additional Aquaporin 1/AQP1 Products

Research Areas for Aquaporin 1/AQP1 Protein (NBP1-84488PEP)

Find related products by research area.

Blogs on Aquaporin 1/AQP1

There are no specific blogs for Aquaporin 1/AQP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aquaporin 1/AQP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP1