AP3B2 Antibody - BSA Free

Western Blot: AP3B2 Antibody [NBP1-81011] - Analysis in control (vector only transfected HEK293T lysate) and AP3B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: AP3B2 Antibody [NBP1-81011] - Staining in human cerebral cortex and pancreas tissues using anti-AP3B2 antibody. Corresponding AP3B2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AP3B2 Antibody [NBP1-81011] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: AP3B2 Antibody [NBP1-81011] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AP3B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AP3B2 Antibody - BSA Free (NBP1-81011) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQ
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP3B2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AP3B2 Protein (NBP1-81011PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AP3B2 Antibody - BSA Free

• Adapter-related protein complex 3 subunit beta-2
• Adaptor protein complex AP-3 subunit beta-2
• adaptor-related protein complex 3, beta 2 subunit
• beta-3B-adaptin
• Clathrin assembly protein complex 3 beta-2 large chain
• DKFZp686D17136
• NAPTBAP-3 complex subunit beta-2
• Neuronal adaptin-like protein, beta-subunit
• Neuron-specific vesicle coat protein beta-NAP

Background

Adaptor protein-3 (AP3) is a heterotetrameric vesicle-coat protein complex. Some AP3 subunits are ubiquitously expressed, whereas others are expressed exclusively in neurons. The neuron-specific AP3 complex, which includes AP3B2, is thought to serve neuron-specific functions such as neurotransmitter release (Grabner et al., 2006 (PubMed 16788073)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP3B2
• Entrez:
  • 8120(Human)
• Uniprot:
  • Q13367(Human)