ANKRD37 Antibody (6E8)

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD37 Antibody (6E8) [H00353322-M02] - Analysis of monoclonal antibody to ANKRD37 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: ANKRD37 Antibody (6E8) [H00353322-M02] - Detection limit for recombinant GST tagged ANKRD37 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
6E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ANKRD37 Antibody (6E8) Summary

Immunogen
ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ANKRD37
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ANKRD37 Antibody (6E8)

  • ankyrin repeat domain 37
  • ankyrin repeat domain-containing protein 37
  • hLrp2bp
  • low density lipoprotein receptor-related protein binding protein
  • Low-density lipoprotein receptor-related protein 2-binding protein
  • LPR2BP
  • Lrp2bp
  • MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2496-ZN
Species: Hu
Applications: EnzAct
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-92642
Species: Hu, Mu, Rt
Applications: ICC/IF, KO, WB
H00002483-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
DPI00
Species: Hu
Applications: ELISA
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77300
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-39004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50214
Species: Hu
Applications: ELISA, IHC, WB
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
DCLU00
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
H00353322-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for ANKRD37 Antibody (H00353322-M02) (0)

There are no publications for ANKRD37 Antibody (H00353322-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD37 Antibody (H00353322-M02) (0)

There are no reviews for ANKRD37 Antibody (H00353322-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANKRD37 Antibody (H00353322-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD37 Products

Bioinformatics Tool for ANKRD37 Antibody (H00353322-M02)

Discover related pathways, diseases and genes to ANKRD37 Antibody (H00353322-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD37 Antibody (H00353322-M02)

Discover more about diseases related to ANKRD37 Antibody (H00353322-M02).
 

Pathways for ANKRD37 Antibody (H00353322-M02)

View related products by pathway.

PTMs for ANKRD37 Antibody (H00353322-M02)

Learn more about PTMs related to ANKRD37 Antibody (H00353322-M02).

Blogs on ANKRD37

There are no specific blogs for ANKRD37, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD37 Antibody (6E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD37
Uniprot