ANKRD34B Antibody

Images

 
Western Blot: ANKRD34B Antibody [NBP2-82609] - Host: Rabbit. Target Name: ANKRD34B. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD34B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD34B. Peptide sequence: KMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD34B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD34B Antibody

  • ankyrin repeat domain 34B
  • DP58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF1636
Species: Hu
Applications: WB, Simple Western, Flow, AgAct, CyTOF-ready, ICC
NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for ANKRD34B Antibody (NBP2-82609) (0)

There are no publications for ANKRD34B Antibody (NBP2-82609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD34B Antibody (NBP2-82609) (0)

There are no reviews for ANKRD34B Antibody (NBP2-82609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD34B Antibody (NBP2-82609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ANKRD34B Products

Bioinformatics Tool for ANKRD34B Antibody (NBP2-82609)

Discover related pathways, diseases and genes to ANKRD34B Antibody (NBP2-82609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD34B

There are no specific blogs for ANKRD34B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD34B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD34B