AMIGO3 Antibody


Western Blot: AMIGO3 Antibody [NBP1-69480] - This Anti-AMIGO3 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

AMIGO3 Antibody Summary

Synthetic peptides corresponding to AMIGO3(adhesion molecule with Ig-like domain 3) The peptide sequence was selected from the N terminal of AMIGO3 (NP_942015). Peptide sequence: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AMIGO3 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AMIGO3 Antibody

  • adhesion molecule with Ig-like domain 3
  • ALI3
  • Alivin-3
  • AMIGO3
  • AMIGO-3
  • amphoterin-induced gene and ORF 3
  • amphoterin-induced protein 3
  • KIAA1851
  • MGC120552


AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for AMIGO3 Antibody (NBP1-69480) (0)

There are no publications for AMIGO3 Antibody (NBP1-69480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMIGO3 Antibody (NBP1-69480) (0)

There are no reviews for AMIGO3 Antibody (NBP1-69480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMIGO3 Antibody (NBP1-69480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AMIGO3 Products

Bioinformatics Tool for AMIGO3 Antibody (NBP1-69480)

Discover related pathways, diseases and genes to AMIGO3 Antibody (NBP1-69480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMIGO3 Antibody (NBP1-69480)

Discover more about diseases related to AMIGO3 Antibody (NBP1-69480).

Pathways for AMIGO3 Antibody (NBP1-69480)

View related products by pathway.

Blogs on AMIGO3

There are no specific blogs for AMIGO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AMIGO3 Antibody and receive a gift card or discount.


Gene Symbol AMIGO3