alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen

Images

 
There are currently no images for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human alpha-1B Adrenergic R/ADRA1B.

Source: E. coli

Amino Acid Sequence: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADRA1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57288.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen

  • a-1B AdrenergicR
  • ADRA1
  • ADRA1B
  • adrenergic, alpha-1B-, receptor
  • alpha-1B Adrenergic R
  • alpha-1B adrenergic receptor
  • alpha1B AdrenergicR
  • Alpha-1B adrenoceptor
  • Alpha-1B adrenoreceptor
  • alpha-1B-adrenergic receptor
  • ALPHA1BAR

Background

The alpha-1b adrenoceptor is an Adrenergic Receptor that causes contraction of smooth muscle cells and thereby controls vascular tone, blood pressure, and accelerates the development of atherosclerosis. Decreased alpha-1b adrenoceptor is associated with benign prostatic hyperplasia (BPH). This adrenergic receptor also acts as a proto-oncogene when transfected into cell lines where constitutive activation of the receptor induces neoplastic transformation. The alpha-1b adrenoceptor has been documented in adrenal, aorta, blood, various brain regions, eye, heart, kidney, liver, prostate, spinal cord, and spleen. ESTs have been isolated from kidney (normal and cancer) and lung carcinoma libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS12
Species: Bt, Bv, Ca, Eq, Hu, Pm, Po, Pm, Rb, Rt
Applications: IHC,  IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-22452
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
4308-SE
Species: Hu
Applications: EnzAct
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-57288PEP
Species: Hu
Applications: AC

Publications for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP) (0)

There are no publications for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP) (0)

There are no reviews for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-1B Adrenergic R/ADRA1B Products

Research Areas for alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP)

Find related products by research area.

Blogs on alpha-1B Adrenergic R/ADRA1B

There are no specific blogs for alpha-1B Adrenergic R/ADRA1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRA1B