alpha-1A Adrenergic R/ADRA1A Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADRA1A |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for alpha-1A Adrenergic R/ADRA1A Antibody
Background
Expression of this receptor has been reported in prostate, liver, kidney, heart, brain, spinal cord, bladder, and various blood vessels. ESTs have been isolated from liver and testis libraries. Caution: The name ADRA1A has been used to describe both the alpha 1c adrenoceptor (human chromosome 20) and the alpha 1d adrenoceptor (human chromosome 8), and the alpha 1c adrenoceptor is also known as alpha 1a adrenoceptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ha, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Pm, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct, PAGE
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC
Publications for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145) (0)
There are no publications for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145) (0)
There are no reviews for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-1A Adrenergic R/ADRA1A Products
Research Areas for alpha-1A Adrenergic R/ADRA1A Antibody (NBP2-38145)
Find related products by research area.
|
Blogs on alpha-1A Adrenergic R/ADRA1A