ALDH7A1 Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ALDH7A1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38572AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ALDH7A1 Antibody [Alexa Fluor® 488] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).

Sequence:
APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH7A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ALDH7A1 Antibody [Alexa Fluor® 488]

  • aldehyde dehydrogenase 7 family, member A1
  • Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog
  • Alpha-AASA dehydrogenase
  • ATQ1Antiquitin-1
  • Betaine aldehyde dehydrogenase
  • Delta1-piperideine-6-carboxylate dehydrogenase
  • EC 1.2.1
  • EC 1.2.1.3
  • EC 1.2.1.31
  • EC 1.2.1.8
  • EPDalpha-aminoadipic semialdehyde dehydrogenase
  • FLJ11738
  • FLJ92814
  • P6c dehydrogenase
  • PDEantiquitin-1

Background

Antiquitin (Aldh7a1) is an evolutionarily conserved protein believed to play a role in the regulation of cellular turgor. Based on sequence analysis, this protein is classified as a member of the aldehyde dehydrogenase superfamily (1). Analysis of the amount of mRNA in various rat and human tissues indicates that the largest amounts are found in rat kidney and liver and in cultured human hepatoma cells. Only minimal amounts were detected in human peripheral blood leukocytes, rat lung, or cultured human fibroblasts (2). The plant homolog of ATQ1 is thought to be involved in regulating turgor pressure, a function that also would be essential for cells of the mammalian cochlea. Northern blots of 13 human fetal tissues show antiquitin to be highly expressed in cochlea, ovary, eye, heart, and kidney (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB100-2462
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, PEP-ELISA, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-639
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
AF1408
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
NBP3-38572AF488
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for ALDH7A1 Antibody (NBP3-38572AF488) (0)

There are no publications for ALDH7A1 Antibody (NBP3-38572AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH7A1 Antibody (NBP3-38572AF488) (0)

There are no reviews for ALDH7A1 Antibody (NBP3-38572AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH7A1 Antibody (NBP3-38572AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH7A1 Products

Array NBP3-38572AF488

Research Areas for ALDH7A1 Antibody (NBP3-38572AF488)

Find related products by research area.

Blogs on ALDH7A1

There are no specific blogs for ALDH7A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH7A1 Antibody [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH7A1