AKAP7 Recombinant Protein Antigen

Images

 
There are currently no images for AKAP7 Protein (NBP1-89171PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AKAP7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP7.

Source: E.coli

Amino Acid Sequence: HVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89171.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for AKAP7 Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein 7
  • AKAP 18
  • AKAP15
  • AKAP18A-kinase anchor protein 7 isoform alpha
  • AKAP-7 isoform gamma
  • AKAP-7 isoforms alpha and beta
  • A-kinase anchor protein 18 kDa
  • A-kinase anchor protein 7 isoform gamma
  • A-kinase anchor protein 7 isoforms alpha and beta
  • A-kinase anchor protein 7
  • A-kinase anchor protein 9 kDa
  • A-kinase anchor protein, 18-kD
  • A-kinase anchoring protein 18
  • protein kinase A anchoring protein 7
  • Protein kinase A-anchoring protein 7 isoform gamma
  • Protein kinase A-anchoring protein 7 isoforms alpha/beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19807
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NB300-869
Species: Mu
Applications: WB, PEP-ELISA
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-61604
Species: Hu, Sh
Applications: WB (-), IP
NBP1-89171PEP
Species: Hu
Applications: AC

Publications for AKAP7 Protein (NBP1-89171PEP) (0)

There are no publications for AKAP7 Protein (NBP1-89171PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP7 Protein (NBP1-89171PEP) (0)

There are no reviews for AKAP7 Protein (NBP1-89171PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AKAP7 Protein (NBP1-89171PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional AKAP7 Products

Bioinformatics Tool for AKAP7 Protein (NBP1-89171PEP)

Discover related pathways, diseases and genes to AKAP7 Protein (NBP1-89171PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP7 Protein (NBP1-89171PEP)

Discover more about diseases related to AKAP7 Protein (NBP1-89171PEP).
 

Pathways for AKAP7 Protein (NBP1-89171PEP)

View related products by pathway.

PTMs for AKAP7 Protein (NBP1-89171PEP)

Learn more about PTMs related to AKAP7 Protein (NBP1-89171PEP).
 

Research Areas for AKAP7 Protein (NBP1-89171PEP)

Find related products by research area.

Blogs on AKAP7

There are no specific blogs for AKAP7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AKAP7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP7