AIPL1 Recombinant Protein Antigen

Images

 
There are currently no images for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AIPL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AIPL1.

Source: E. coli

Amino Acid Sequence: AEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AIPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55506.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AIPL1 Recombinant Protein Antigen

  • AIPL2
  • aryl hydrocarbon receptor interacting protein-like 1
  • aryl hydrocarbon receptor-interacting protein-like 1
  • aryl-hydrocarbon-interacting protein-like 1
  • LCA4

Background

Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are diagnosed at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor/pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NBP2-56113
Species: Hu
Applications: IHC,  IHC-P
NBP2-55753
Species: Hu
Applications: IHC,  IHC-P
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-38638
Species: Hu
Applications: IHC,  IHC-P, WB
H00145226-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-03897
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31401
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-55416
Species: Hu
Applications: WB
NBP2-50444
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
AF591
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-31347
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP) (0)

There are no publications for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP) (0)

There are no reviews for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP). (Showing 1 - 1 of 1 FAQ).

  1. For my project I'm interested in an primary antibody that is not currently available on the market. The protein I'm interested in is aryl hydrocarbon receptor interacting protein. I would like to use the antibody for Western Blot and/or Immunoprecipitation, and this antibody has to be specific for a zebra fish protein. I would like to ask for a price quote.
    • We currently have no AIPL1 antibodies validated in Zebra fish. If you are interested in testing in Zebra fish, you would qualify for our Innovators Reward Program. You may also contact us at innovators@novusbio.com should you have any questions about the Innovators Reward Program.

Additional AIPL1 Products

Research Areas for AIPL1 Recombinant Protein Antigen (NBP2-55506PEP)

Find related products by research area.

Blogs on AIPL1

There are no specific blogs for AIPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AIPL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AIPL1