Recombinant Human AIPL1 GST (N-Term) Protein

SDS-Page: Recombinant Human AIPL1 Protein [H00023746-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human AIPL1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-101 of Human AIPL1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: AIPL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIPL1 GST (N-Term) Protein

• AIPL2
• aryl hydrocarbon receptor interacting protein-like 1
• aryl hydrocarbon receptor-interacting protein-like 1
• aryl-hydrocarbon-interacting protein-like 1
• LCA4

Background

Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are diagnosed at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor/pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for AIPL1 Partial Recombinant Protein (H00023746-Q01). (Showing 1 - 1 of 1 FAQ).

1. For my project I'm interested in an primary antibody that is not currently available on the market. The protein I'm interested in is aryl hydrocarbon receptor interacting protein. I would like to use the antibody for Western Blot and/or Immunoprecipitation, and this antibody has to be specific for a zebra fish protein. I would like to ask for a price quote.
   • We currently have no AIPL1 antibodies validated in Zebra fish. If you are interested in testing in Zebra fish, you would qualify for our Innovators Reward Program. You may also contact us at innovators@novusbio.com should you have any questions about the Innovators Reward Program.

Bioinformatics

• Gene Symbol: AIPL1