Recombinant Human AIPL1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human AIPL1 Protein [H00023746-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related AIPL1 Peptides and Proteins

Order Details


    • Catalog Number
      H00023746-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human AIPL1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-101 of Human AIPL1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AIPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIPL1 GST (N-Term) Protein

  • AIPL2
  • aryl hydrocarbon receptor interacting protein-like 1
  • aryl hydrocarbon receptor-interacting protein-like 1
  • aryl-hydrocarbon-interacting protein-like 1
  • LCA4

Background

Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are diagnosed at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor/pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NBP2-56113
Species: Hu
Applications: IHC,  IHC-P
NBP2-55753
Species: Hu
Applications: IHC,  IHC-P
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-38638
Species: Hu
Applications: IHC,  IHC-P, WB
H00145226-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-03897
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31401
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-55416
Species: Hu
Applications: WB
NBP2-50444
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
AF591
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-31347
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for AIPL1 Partial Recombinant Protein (H00023746-Q01) (0)

There are no publications for AIPL1 Partial Recombinant Protein (H00023746-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIPL1 Partial Recombinant Protein (H00023746-Q01) (0)

There are no reviews for AIPL1 Partial Recombinant Protein (H00023746-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIPL1 Partial Recombinant Protein (H00023746-Q01). (Showing 1 - 1 of 1 FAQ).

  1. For my project I'm interested in an primary antibody that is not currently available on the market. The protein I'm interested in is aryl hydrocarbon receptor interacting protein. I would like to use the antibody for Western Blot and/or Immunoprecipitation, and this antibody has to be specific for a zebra fish protein. I would like to ask for a price quote.
    • We currently have no AIPL1 antibodies validated in Zebra fish. If you are interested in testing in Zebra fish, you would qualify for our Innovators Reward Program. You may also contact us at innovators@novusbio.com should you have any questions about the Innovators Reward Program.

Additional AIPL1 Products

Research Areas for AIPL1 Partial Recombinant Protein (H00023746-Q01)

Find related products by research area.

Blogs on AIPL1

There are no specific blogs for AIPL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AIPL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIPL1