AHNAK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AHNAK2 Antibody [NBP1-88428] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: AHNAK2 Antibody [NBP1-88428] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AHNAK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AHNAK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AHNAK2 Protein (NBP1-88428PEP)
Publications
Read Publication using NBP1-88428.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AHNAK2 Antibody

  • AHNAK nucleoprotein 2
  • C14orf78
  • chromosome 14 open reading frame 78
  • KIAA2019
  • protein AHNAK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-89598
Species: Hu, Mu, Ca
Applications: IHC, IHC-Fr, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP1-88428
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AHNAK2 Antibody (NBP1-88428)(1)

Reviews for AHNAK2 Antibody (NBP1-88428) (0)

There are no reviews for AHNAK2 Antibody (NBP1-88428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AHNAK2 Antibody (NBP1-88428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AHNAK2 Products

Bioinformatics Tool for AHNAK2 Antibody (NBP1-88428)

Discover related pathways, diseases and genes to AHNAK2 Antibody (NBP1-88428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AHNAK2 Antibody (NBP1-88428)

Discover more about diseases related to AHNAK2 Antibody (NBP1-88428).
 

Pathways for AHNAK2 Antibody (NBP1-88428)

View related products by pathway.

PTMs for AHNAK2 Antibody (NBP1-88428)

Learn more about PTMs related to AHNAK2 Antibody (NBP1-88428).

Blogs on AHNAK2

There are no specific blogs for AHNAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AHNAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AHNAK2