Recombinant Human AGPAT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AGPAT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-283 of Human AGPAT1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AGPAT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AGPAT1 Protein

  • 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase)
  • 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha)
  • 1-acylglycerol-3-phosphate O-acyltransferase 1
  • 1-AGP acyltransferase 1
  • 1-AGPAT1
  • EC 2.3.1.51
  • G15
  • LPAATA
  • LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
  • Lysophosphatidic acid acyltransferase alpha
  • lysophospholipid acyltransferase
  • MGC4007,1-AGPAT 1
  • MGC5423
  • Protein G15

Background

This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-04299
Species: Hu
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88921
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
MAB5018
Species: Hu
Applications: WB, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00063940-M01
Species: Hu
Applications: WB, ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010555-D01P
Species: Hu
Applications: WB, ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-55258
Species: Hu
Applications: WB
H00010554-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AGPAT1 Recombinant Protein (H00010554-P01) (0)

There are no publications for AGPAT1 Recombinant Protein (H00010554-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT1 Recombinant Protein (H00010554-P01) (0)

There are no reviews for AGPAT1 Recombinant Protein (H00010554-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPAT1 Recombinant Protein (H00010554-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGPAT1 Products

Bioinformatics Tool for AGPAT1 Recombinant Protein (H00010554-P01)

Discover related pathways, diseases and genes to AGPAT1 Recombinant Protein (H00010554-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT1 Recombinant Protein (H00010554-P01)

Discover more about diseases related to AGPAT1 Recombinant Protein (H00010554-P01).
 

Pathways for AGPAT1 Recombinant Protein (H00010554-P01)

View related products by pathway.

PTMs for AGPAT1 Recombinant Protein (H00010554-P01)

Learn more about PTMs related to AGPAT1 Recombinant Protein (H00010554-P01).

Blogs on AGPAT1

There are no specific blogs for AGPAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AGPAT1 Antibody
NBP2-57898

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AGPAT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT1