Recombinant Human ADPGK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ADPGK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 425-496 of Human ADPGK

Source: Wheat Germ

Amino Acid Sequence: SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADPGK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00083440-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADPGK Protein

  • ADP-dependent glucokinase
  • ADP-GKrbBP-35
  • ATP-dependent glucokinase
  • DKFZp434B195
  • EC 2.7.1.147,2610017G09Rik
  • RbBP-35

Background

ADPGK - ADP-dependent glucokinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38542
Species: Hu
Applications: WB, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-64644
Species: Hu
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADPGK Partial Recombinant Protein (H00083440-Q01)(1)


Reviews for ADPGK Partial Recombinant Protein (H00083440-Q01) (0)

There are no reviews for ADPGK Partial Recombinant Protein (H00083440-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADPGK Partial Recombinant Protein (H00083440-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADPGK Products

Bioinformatics Tool for ADPGK Partial Recombinant Protein (H00083440-Q01)

Discover related pathways, diseases and genes to ADPGK Partial Recombinant Protein (H00083440-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADPGK Partial Recombinant Protein (H00083440-Q01)

Discover more about diseases related to ADPGK Partial Recombinant Protein (H00083440-Q01).
 

Pathways for ADPGK Partial Recombinant Protein (H00083440-Q01)

View related products by pathway.

PTMs for ADPGK Partial Recombinant Protein (H00083440-Q01)

Learn more about PTMs related to ADPGK Partial Recombinant Protein (H00083440-Q01).

Blogs on ADPGK

There are no specific blogs for ADPGK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ADPGK Antibody (1E4)
H00083440-M01
Kif2a Antibody
NB500-180

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADPGK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADPGK