Adenylate Kinase 8 Antibody

Images

 
Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88242] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenylate Kinase 8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AK8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Adenylate Kinase 8 Recombinant Protein Antigen (NBP1-88242PEP)

Reactivity Notes

Mouse (81%) Rat (81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenylate Kinase 8 Antibody

  • adenylate kinase 8
  • C9orf98
  • chromosome 9 open reading frame 98
  • DDX31
  • EC 2.7.4.3
  • FLJ32704
  • FLJ36014
  • putative adenylate kinase-like protein C9orf98
  • RP11-143F18.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-32560
Species: Hu
Applications: ICC/IF, WB
NBP1-83482
Species: Hu
Applications: IHC, IHC-P, WB
AF1001
Species: Mu
Applications: IHC
NBP1-20229
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45679
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS5103
Species: Bv, Ca, Hu
Applications: ICC, IHC, IHC-P
NBP2-02978
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-10310
Species: Hu
Applications: WB
AF6739
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-17061
Species: Hu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Adenylate Kinase 8 Antibody (NBP1-88242) (0)

There are no publications for Adenylate Kinase 8 Antibody (NBP1-88242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 8 Antibody (NBP1-88242) (0)

There are no reviews for Adenylate Kinase 8 Antibody (NBP1-88242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Adenylate Kinase 8 Antibody (NBP1-88242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylate Kinase 8 Products

Bioinformatics Tool for Adenylate Kinase 8 Antibody (NBP1-88242)

Discover related pathways, diseases and genes to Adenylate Kinase 8 Antibody (NBP1-88242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Kinase 8 Antibody (NBP1-88242)

Discover more about diseases related to Adenylate Kinase 8 Antibody (NBP1-88242).
 

Pathways for Adenylate Kinase 8 Antibody (NBP1-88242)

View related products by pathway.

PTMs for Adenylate Kinase 8 Antibody (NBP1-88242)

Learn more about PTMs related to Adenylate Kinase 8 Antibody (NBP1-88242).

Blogs on Adenylate Kinase 8

There are no specific blogs for Adenylate Kinase 8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylate Kinase 8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK8