Adenylate Cyclase 8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Adenylate Cyclase 8 Antibody [NBP1-90278] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Adenylate Cyclase 8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Adenylate Cyclase 8 Antibody - BSA Free (NBP1-90278) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADCY8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Adenylate Cyclase 8 Protein (NBP1-90278PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Adenylate Cyclase 8 Antibody - BSA Free

• AC8
• ADCY3
• ADCY8
• adenylate cyclase 8 (brain)
• Adenylate Cyclase 8
• adenylate cyclase type 8
• Adenylate cyclase type VIII
• Adenylyl cyclase 8
• adenylyl cyclase-8, brain
• ATP pyrophosphate-lyase 8
• Ca(2+)/calmodulin-activated adenylyl cyclase
• EC 4.6.1.1
• HBAC1

Background

ADCY8, also known as Adenylate cyclase type 8, is a 140 kDa 1,251 amino acid protein, and is involved in the encoding of a membrane-bound enzyme that has to do with learning. This protein has also been shown to have interactions with CALM1, CALM2, CALM3, PPP2CA, and CFTR in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY8 and drug dependence, bipolar disorder, cholera, and Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADCY8