Adenylate Cyclase 8 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADCY8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Adenylate Cyclase 8 Antibody - BSA Free
Background
ADCY8, also known as Adenylate cyclase type 8, is a 140 kDa 1,251 amino acid protein, and is involved in the encoding of a membrane-bound enzyme that has to do with learning. This protein has also been shown to have interactions with CALM1, CALM2, CALM3, PPP2CA, and CFTR in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY8 and drug dependence, bipolar disorder, cholera, and Alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rb, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Publications for Adenylate Cyclase 8 Antibody (NBP1-90278) (0)
There are no publications for Adenylate Cyclase 8 Antibody (NBP1-90278).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenylate Cyclase 8 Antibody (NBP1-90278) (0)
There are no reviews for Adenylate Cyclase 8 Antibody (NBP1-90278).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Adenylate Cyclase 8 Antibody (NBP1-90278) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adenylate Cyclase 8 Products
Research Areas for Adenylate Cyclase 8 Antibody (NBP1-90278)
Find related products by research area.
|
Blogs on Adenylate Cyclase 8