Adenylate Cyclase 5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Adenylate Cyclase 5 Antibody - BSA Free (NBP2-57976) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF',) |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADCY5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Adenylate Cyclase 5 Antibody - BSA Free
Background
ADCY5, also known as Adenylate cyclase type 5, consists of a 1,261 amino acid long isoform that is 139 kDa and a shorter 911 amino acid isoform that is 103 kDa, and is involved in the encoding of a membrane-bound enzyme. This protein has also been shown to have interactions with ADCY2, GNAS, PRKACA, GNAI1, and PRKCA in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY5 and pancreatitis, leukemia, precocious puberty, and immunodeficiency.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rb, Rt
Applications: ELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF
Publications for Adenylate Cyclase 5 Antibody (NBP2-57976) (0)
There are no publications for Adenylate Cyclase 5 Antibody (NBP2-57976).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenylate Cyclase 5 Antibody (NBP2-57976) (0)
There are no reviews for Adenylate Cyclase 5 Antibody (NBP2-57976).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Adenylate Cyclase 5 Antibody (NBP2-57976) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adenylate Cyclase 5 Products
Research Areas for Adenylate Cyclase 5 Antibody (NBP2-57976)
Find related products by research area.
|
Blogs on Adenylate Cyclase 5