Adenylate Cyclase 2 Antibody


Immunohistochemistry: Adenylate Cyclase 2 Antibody [NBP1-90280] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Adenylate Cyclase 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Adenylate Cyclase 2 Protein (NBP1-90280PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Adenylate Cyclase 2 Antibody

  • 3'-5'-cyclic AMP synthetase
  • AC2
  • adenylate cyclase 2 (brain)
  • adenylate cyclase II
  • adenylate cyclase type 2
  • Adenylate cyclase type II
  • Adenylyl cyclase 2
  • ATP pyrophosphate-lyase 2
  • EC
  • FLJ45092
  • HBAC2
  • KIAA1060FLJ16822
  • MGC133314
  • type II adenylate cyclase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenylate Cyclase 2 Antibody (NBP1-90280) (0)

There are no publications for Adenylate Cyclase 2 Antibody (NBP1-90280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Cyclase 2 Antibody (NBP1-90280) (0)

There are no reviews for Adenylate Cyclase 2 Antibody (NBP1-90280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Adenylate Cyclase 2 Antibody (NBP1-90280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Adenylate Cyclase 2 Products

Bioinformatics Tool for Adenylate Cyclase 2 Antibody (NBP1-90280)

Discover related pathways, diseases and genes to Adenylate Cyclase 2 Antibody (NBP1-90280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Cyclase 2 Antibody (NBP1-90280)

Discover more about diseases related to Adenylate Cyclase 2 Antibody (NBP1-90280).

Pathways for Adenylate Cyclase 2 Antibody (NBP1-90280)

View related products by pathway.

PTMs for Adenylate Cyclase 2 Antibody (NBP1-90280)

Learn more about PTMs related to Adenylate Cyclase 2 Antibody (NBP1-90280).

Research Areas for Adenylate Cyclase 2 Antibody (NBP1-90280)

Find related products by research area.

Blogs on Adenylate Cyclase 2

There are no specific blogs for Adenylate Cyclase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Adenylate Cyclase 2 Antibody and receive a gift card or discount.


Gene Symbol ADCY2