ADAM30 Antibody

Images

 
Western Blot: ADAM30 Antibody [NBP1-86980] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ADAM30 Antibody [NBP1-86980] - Staining of human appendix shows distinct positivity of intracellular material in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNLIGDQFGNCEITGIRNFKKCESANSICGRLQCINVETIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPMGIPDLGMINDGTSCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Appendix Lysate (NB820-59343)
Control Peptide
ADAM30 Protein (NBP1-86980PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAM30 Antibody

  • a disintegrin and metalloproteinase domain 30
  • ADAM 30
  • ADAM metallopeptidase domain 30
  • disintegrin and metalloproteinase domain-containing protein 30
  • EC 3.4.24.-
  • svph4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32796
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00011086-M09
Species: Hu
Applications: WB, ELISA
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-86980
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ADAM30 Antibody (NBP1-86980) (0)

There are no publications for ADAM30 Antibody (NBP1-86980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM30 Antibody (NBP1-86980) (0)

There are no reviews for ADAM30 Antibody (NBP1-86980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM30 Antibody (NBP1-86980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ADAM30 Products

Bioinformatics Tool for ADAM30 Antibody (NBP1-86980)

Discover related pathways, diseases and genes to ADAM30 Antibody (NBP1-86980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM30 Antibody (NBP1-86980)

Discover more about diseases related to ADAM30 Antibody (NBP1-86980).

Blogs on ADAM30

There are no specific blogs for ADAM30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM30
Entrez
Uniprot