ADAM21 Antibody

Immunohistochemistry-Paraffin: ADAM21 Antibody [NBP2-32414] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Product Discontinued

ADAM21 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MQHDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADAM21 Antibody

• a disintegrin and metalloproteinase domain 21
• ADAM 21
• ADAM metallopeptidase domain 21
• ADAM metallopeptidase domain 21, preproprotein
• ADAM31
• disintegrin and metalloproteinase domain-containing protein 21
• EC 3.4.24.-
• MGC125389

Background

ADAM21 encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene lacks introns and its expression is testis-specific. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM21