ADAM20 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DAFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKLGVAYVKGICQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAM20 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ADAM20 Antibody - BSA Free
Background
ADAM20, or Disintegrin and metalloproteinase domain-containing protein 20, consists of a 726 amino acid isoform that is 82 kDa, and is involved in the processes of fertilization and sperm maturation. Research is not currently being conducted on ADAM20's relation to any diseases or disorders. The protein has been linked to the processes of proteolysis and single fertilization.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ELISA, IHC, IHC-Fr, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for ADAM20 Antibody (NBP2-38872) (0)
There are no publications for ADAM20 Antibody (NBP2-38872).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM20 Antibody (NBP2-38872) (0)
There are no reviews for ADAM20 Antibody (NBP2-38872).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ADAM20 Antibody (NBP2-38872) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAM20 Products
Blogs on ADAM20