ADA2 beta Antibody

Western Blot: ADA2 beta Antibody [NBP1-91649] - Analysis in human testis tissue.

Immunocytochemistry/Immunofluorescence: ADA2 beta Antibody [NBP1-91649] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ADA2 beta Antibody [NBP1-91649] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ADA2 beta Antibody [NBP1-91649] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: ADA2 beta Antibody [NBP1-91649] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry: ADA2 beta Antibody [NBP1-91649] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Product Discontinued

ADA2 beta Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSRE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TADA2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADA2 beta Antibody

• ADA2-beta
• ADA2-like protein beta
• MGC21874
• transcriptional adapter 2-beta
• transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
• transcriptional adaptor 2B

Background

Coactivates PAX5-dependent transcription together with either SMARCA4 or GCN5L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TADA2B
• Entrez:
  • 93624(Human)
• Uniprot:
  • Q86TJ2(Human)