ACTRT2 Antibody (2E10) - Azide and BSA Free

Western Blot: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of ACTRT2 expression in HepG2 (Cat # L019V1).

Immunohistochemistry-Paraffin: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of monoclonal antibody to ACTRT2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

Western Blot: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of ACTRT2 expression in transfected 293T cell line by ACTRT2 monoclonal antibody (M03), clone 2E10. Lane 1: ACTRT2 transfected lysatE (41.7 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ACTRT2 Antibody (2E10) - Azide and BSA Free Summary

• Immunogen: ACTRT2 (NP_536356, 209 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
• Specificity: ACTRT2 - actin-related protein T2 (2E10)
• Isotype: IgG2a Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: ACTRT2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACTRT2 Antibody (2E10) - Azide and BSA Free

• actin-related protein hArpM2
• Actin-related protein M2
• actin-related protein T2
• ARPM2HARPM2
• ARPT2
• Arp-T2
• FLJ25424

Background

The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTRT2
• Entrez:
  • 140625(Human)
• Uniprot:
  • NP_536356(Human)