ACTRT2 Antibody (2E10)

Images

 
Western Blot: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of ACTRT2 expression in HepG2 (Cat # L019V1).
Immunohistochemistry-Paraffin: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of monoclonal antibody to ACTRT2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
Western Blot: ACTRT2 Antibody (2E10) [H00140625-M03] - Analysis of ACTRT2 expression in transfected 293T cell line by ACTRT2 monoclonal antibody (M03), clone 2E10. Lane 1: ACTRT2 transfected lysatE (41.7 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACTRT2 Antibody (2E10) Summary

Immunogen
ACTRT2 (NP_536356, 209 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Specificity
ACTRT2 - actin-related protein T2 (2E10)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
ACTRT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACTRT2 Antibody (2E10)

  • actin-related protein hArpM2
  • Actin-related protein M2
  • actin-related protein T2
  • ARPM2HARPM2
  • ARPT2
  • Arp-T2
  • FLJ25424

Background

The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90910
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-53182
Species: Hu
Applications: WB
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56428
Species: Hu
Applications: IHC, IHC-P
H00140625-M03
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for ACTRT2 Antibody (H00140625-M03) (0)

There are no publications for ACTRT2 Antibody (H00140625-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTRT2 Antibody (H00140625-M03) (0)

There are no reviews for ACTRT2 Antibody (H00140625-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTRT2 Antibody (H00140625-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTRT2 Products

Bioinformatics Tool for ACTRT2 Antibody (H00140625-M03)

Discover related pathways, diseases and genes to ACTRT2 Antibody (H00140625-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ACTRT2

There are no specific blogs for ACTRT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTRT2 Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT2
Entrez
Uniprot