ACF1 Antibody [mFluor Violet 500 SE] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1347-1556 of human ACF1 (NP_038476.2).
Sequence: VFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BAZ1A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for ACF1 Antibody [mFluor Violet 500 SE]
Background
ACF1/BAZ1A is a subunit of the ACF chromatin-remodeling complex and the ISWI CHRAC remodeling complex. In the ACF complex, ACF1/BAZ1A functions to influence the nucleosome remodeling activity of the SNF2h ATPase. As part of the CHRAC complex, ACF1/BAZ1A may function to target CHRAC to heterochromatin. ACF1 has also been shown to interact with the nuclear receptor corepressor protein (N-CoR) to facilitate the repression of transcription by unliganded nuclear receptors. Alternate names for ACF1/BAZ1A include ATP-utilizing chromatin assembly and remodeling factor1, hACF1, bromodomain adjacent to zinc finger domain protein 1A, Williams syndrome transcription factor-related chromatin-remodeling factor 180, WCRF180, hWALp1, and CHRAC subunit ACF1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA
Species: Hu, Mu, Rt
Applications: KO, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for ACF1 Antibody (NBP3-38624MFV500) (0)
There are no publications for ACF1 Antibody (NBP3-38624MFV500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACF1 Antibody (NBP3-38624MFV500) (0)
There are no reviews for ACF1 Antibody (NBP3-38624MFV500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACF1 Antibody (NBP3-38624MFV500) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ACF1 Products
Blogs on ACF1