ACCN1 Recombinant Protein Antigen

Images

 
There are currently no images for ACCN1 Protein (NBP2-14321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACCN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASIC2.

Source: E. coli

Amino Acid Sequence: LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASIC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14321.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACCN1 Recombinant Protein Antigen

  • Acid-sensing ion channel 2
  • Amiloride-sensitive brain sodium channel
  • amiloride-sensitive cation channel 1, neuronal
  • ASIC2a
  • ASIC2Mammalian degenerin homolog
  • BNAC1
  • BNaC1ACCN
  • BNC1Amiloride-sensitive cation channel neuronal 1
  • degenerin
  • hBNaC1
  • MDEGBrain sodium channel 1
  • neuronal amiloride-sensitive cation channel 1

Background

FUNCTION: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.; SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins. Interacts with STOM. Interacts with PRKCABP and ACCN3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. Note: Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22409
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-46288
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-15241
Species: Hu
Applications: WB
DBD00
Species: Hu
Applications: ELISA
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-69078
Species: Mu
Applications: WB
AF1056
Species: Rt
Applications: IHC, WB
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
268-N4
Species: Hu
Applications: BA
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for ACCN1 Protein (NBP2-14321PEP) (0)

There are no publications for ACCN1 Protein (NBP2-14321PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACCN1 Protein (NBP2-14321PEP) (0)

There are no reviews for ACCN1 Protein (NBP2-14321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACCN1 Protein (NBP2-14321PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACCN1 Products

Research Areas for ACCN1 Protein (NBP2-14321PEP)

Find related products by research area.

Blogs on ACCN1

There are no specific blogs for ACCN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACCN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC2