ABLIM3 Antibody - Azide and BSA Free

Western Blot: ABLIM3 Antibody [H00022885-B01P] - Analysis of ABLIM3 expression in transfected 293T cell line by ABLIM3 polyclonal antibody. Lane 1: ABLIM3 transfected lysate(59.84 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ABLIM3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ABLIM3 Antibody - Azide and BSA Free (H00022885-B01P) is a polyclonal antibody validated for use in WB. Anti-ABLIM3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ABLIM3 (AAH01665.1, 1 a.a. - 544 a.a.) full-length human protein. MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEGNFWKSGCL
• Specificity: ABLIM3 - actin binding LIM protein family, member 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ABLIM3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABLIM3 Antibody - Azide and BSA Free

• actin binding LIM protein family, member 3
• actin-binding LIM protein 3

Background

The LIM domain is a double zinc finger structure that promotes protein-protein interactions. LIM domain proteins, such as ABLIM3, play roles in embryonic development, cell lineage determination, and cancer (Krupp et al., 2006 [PubMed 16328021]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABLIM3 Antibody (H00022885-B01P)(1)

Publication using H00022885-B01P

• Wang X, Su B, Siedlak SL et al. Amyloid-{beta} overproduction causes abnormal mitochondrial dynamics via differential modulation of mitochondrial fission/fusion proteins. Proc Natl Acad Sci U S A 2008-12-09 [PMID: 19050078]

Bioinformatics

• Gene Symbol: ABLIM3
• Entrez:
  • 22885(Human)
• Uniprot:
  • AAH01665.1(Human)