ABCB10 Antibody - Azide and BSA Free

Western Blot: ABCB10 Antibody [NBP2-92618] - Analysis of extracts of various cell lines, using ABCB10 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: ABCB10 Antibody [NBP2-92618] - Analysis of NIH/3T3 cells using ABCB10 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: ABCB10 Antibody [NBP2-92618] - Analysis of C6 cells using ABCB10 at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Discontinued

ABCB10 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 230-300 of human ABCB10 (NP_036221.2). AIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ABCB10 Antibody - Azide and BSA Free

• ABC transporter 10 protein
• ATP-binding cassette, sub-family B (MDR/TAP), member 10
• EC 3.6.3
• EC 3.6.3.44
• EST20237
• M-ABC2ATP-binding cassette transporter 10
• Mitochondrial ATP-binding cassette 2
• MTABC2ATP-binding cassette sub-family B member 10, mitochondrial

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ABCB10