A2LD1 Antibody

Images

 
Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining in human kidney and lymph node tissues using anti-GGACT antibody. Corresponding GGACT RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

A2LD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP
Specificity
Specificity of human A2LD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGACT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
A2LD1 Protein (NBP2-38064PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for A2LD1 Antibody

  • AIG2-like domain 1
  • AIG2-like domain-containing protein 1
  • gamma-glutamylamine cyclotransferase
  • gamma-glutamylaminecyclotransferase
  • GGACT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
AF5086
Species: Hu
Applications: WB
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for A2LD1 Antibody (NBP2-38064) (0)

There are no publications for A2LD1 Antibody (NBP2-38064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A2LD1 Antibody (NBP2-38064) (0)

There are no reviews for A2LD1 Antibody (NBP2-38064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for A2LD1 Antibody (NBP2-38064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for A2LD1 Antibody (NBP2-38064)

Discover related pathways, diseases and genes to A2LD1 Antibody (NBP2-38064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A2LD1 Antibody (NBP2-38064)

Discover more about diseases related to A2LD1 Antibody (NBP2-38064).

PTMs for A2LD1 Antibody (NBP2-38064)

Learn more about PTMs related to A2LD1 Antibody (NBP2-38064).

Blogs on A2LD1

There are no specific blogs for A2LD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A2LD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGACT
Uniprot