![Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/A2LD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38064-img0003.jpg "Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human lymph node shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit A2LD1 Antibody - BSA Free (NBP2-38064) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GGACT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/A2LD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38064-img0002.jpg "Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining in human kidney and lymph node tissues using anti-GGACT antibody. Corresponding GGACT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/A2LD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38064-img0004.jpg "Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining in human kidney and lymph node tissues using anti-GGACT antibody. Corresponding GGACT RNA-seq data are presented for the same tissues.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![ADAM33 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ADAM33 Antibody [Unconjugated]")
![Western Blot Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Western_Blot_11080.jpg)
![Simple Western Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Simple_Western_17620.jpg)
![Knockout Validated Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images/af4376_human-mouse-rat-transglutaminase-2-tgm2-aff-purified-pab-20820241518569.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")