Recombinant Human 58K Golgi Protein Protein

Images

 
Western Blot: 58K Golgi Protein Partial Recombinant Protein [H00010841-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human 58K Golgi Protein Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 440-541 of Human 58K Golgi Protein

Source: Wheat Germ

Amino Acid Sequence: LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FTCD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 58K Golgi Protein Protein

  • formimidoyltransferase cyclodeaminase
  • formimidoyltransferase-cyclodeaminase
  • formiminotransferase cyclodeaminase
  • Formiminotransferase-cyclodeaminase
  • human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase
  • LCHC1

Background

FTCD - formiminotransferase cyclodeaminase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
7268-CT
NBP2-67020
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF6466
Species: Hu
Applications: WB
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-57749
Species: Hu
Applications: WB, IHC
H00010841-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01) (0)

There are no publications for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01) (0)

There are no reviews for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01)

Discover related pathways, diseases and genes to 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01)

Discover more about diseases related to 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01).
 

Pathways for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01)

View related products by pathway.

PTMs for 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01)

Learn more about PTMs related to 58K Golgi Protein Partial Recombinant Protein (H00010841-Q01).

Blogs on 58K Golgi Protein

There are no specific blogs for 58K Golgi Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTLA-4
7268-CT-100

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 58K Golgi Protein Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FTCD