ZNF692 Antibody - BSA Free

Western Blot: ZNF692 Antibody [NBP2-56800] - Analysis in human cerebellum tissue.

Immunocytochemistry/Immunofluorescence: ZNF692 Antibody [NBP2-56800] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

ChIP-Exo-Seq composite graph for Anti-ZNF692 (NBP2-56800) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF692 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCP
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF692
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF692 Recombinant Protein Antigen (NBP2-56800PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF692 Antibody - BSA Free

• AICAR responsive element binding protein
• AREBP
• FLJ20531
• Zfp692
• zinc finger protein 692

Background

ZNF692 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF692 Antibody (NBP2-56800)(1)

Publication using NBP2-56800

• Xing Y, Ren S, Ai L et al. ZNF692 promotes colon adenocarcinoma cell growth and metastasis by activating the PI3K/AKT pathway Int. J. Oncol. 2019-02-27 [PMID: 30816443] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: ZNF692