ZNF499 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF499 Antibody [NBP1-92627] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: ZNF499 Antibody [NBP1-92627] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF499 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCW
Specificity
Specificity of human ZNF499 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF499 Protein (NBP1-92627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF499 Antibody

  • DKFZp547H249
  • FLJ14486
  • zinc finger and BTB domain containing 45
  • zinc finger and BTB domain-containing protein 45
  • zinc finger protein 499
  • ZNF499

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051003-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92627
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF499 Antibody (NBP1-92627) (0)

There are no publications for ZNF499 Antibody (NBP1-92627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF499 Antibody (NBP1-92627) (0)

There are no reviews for ZNF499 Antibody (NBP1-92627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF499 Antibody (NBP1-92627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF499 Products

Bioinformatics Tool for ZNF499 Antibody (NBP1-92627)

Discover related pathways, diseases and genes to ZNF499 Antibody (NBP1-92627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF499 Antibody (NBP1-92627)

Discover more about diseases related to ZNF499 Antibody (NBP1-92627).
 

Pathways for ZNF499 Antibody (NBP1-92627)

View related products by pathway.

Blogs on ZNF499

There are no specific blogs for ZNF499, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF499 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB45