ZNF499 Antibody


Western Blot: ZNF499 Antibody [NBP1-79966] - Human Lung lysate, concentration 0.015ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZNF499 Antibody Summary

Synthetic peptide directed towards the middle region of human ZNF499. Peptide sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF499 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF499 Antibody

  • DKFZp547H249
  • FLJ14486
  • zinc finger and BTB domain containing 45
  • zinc finger and BTB domain-containing protein 45
  • zinc finger protein 499
  • ZNF499


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB

Publications for ZNF499 Antibody (NBP1-79966) (0)

There are no publications for ZNF499 Antibody (NBP1-79966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF499 Antibody (NBP1-79966) (0)

There are no reviews for ZNF499 Antibody (NBP1-79966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF499 Antibody (NBP1-79966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZNF499 Products

Bioinformatics Tool for ZNF499 Antibody (NBP1-79966)

Discover related pathways, diseases and genes to ZNF499 Antibody (NBP1-79966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF499 Antibody (NBP1-79966)

Discover more about diseases related to ZNF499 Antibody (NBP1-79966).

Pathways for ZNF499 Antibody (NBP1-79966)

View related products by pathway.

Blogs on ZNF499

There are no specific blogs for ZNF499, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF499 Antibody and receive a gift card or discount.


Gene Symbol ZBTB45