Recombinant Human ZNF277 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF277 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-278 of Human ZNF277 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLVRLSFHNLKFDCSTANKIFLRTN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF277

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF277 Protein

  • FLJ40981
  • zinc finger protein 433

Background

ZNF277( AAH20626, 1 a.a. - 279 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60012
Species: Hu
Applications: WB
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-45932
Species: Hu
Applications: WB, IHC, IF
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
H00009732-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
H00171023-M05
Species: Hu
Applications: WB, ELISA

Publications for ZNF277 Recombinant Protein (H00011179-P01) (0)

There are no publications for ZNF277 Recombinant Protein (H00011179-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF277 Recombinant Protein (H00011179-P01) (0)

There are no reviews for ZNF277 Recombinant Protein (H00011179-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF277 Recombinant Protein (H00011179-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF277 Products

Bioinformatics Tool for ZNF277 Recombinant Protein (H00011179-P01)

Discover related pathways, diseases and genes to ZNF277 Recombinant Protein (H00011179-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF277 Recombinant Protein (H00011179-P01)

Discover more about diseases related to ZNF277 Recombinant Protein (H00011179-P01).
 

Pathways for ZNF277 Recombinant Protein (H00011179-P01)

View related products by pathway.

Blogs on ZNF277

There are no specific blogs for ZNF277, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288
ZNF277 Antibody
NBP1-82529
AHR Antibody
NB100-128

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF277 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF277