Recombinant Human ZNF23 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZNF23 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 41-139 of Human ZNF23 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF23 GST (N-Term) Protein

  • FLJ45745
  • MGC2555
  • NOLZ-1
  • zinc finger protein 503

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007580-B01P
Species: Hu
Applications: WB, ICC/IF
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP2-22452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-86497
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-16528
Species: Hu
Applications: WB, ICC/IF
NBP1-81408
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04752
Species: Mu, Rt
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15252
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF23 Partial Recombinant Protein (H00007571-Q01) (0)

There are no publications for ZNF23 Partial Recombinant Protein (H00007571-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF23 Partial Recombinant Protein (H00007571-Q01) (0)

There are no reviews for ZNF23 Partial Recombinant Protein (H00007571-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF23 Partial Recombinant Protein (H00007571-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ZNF23 Products

Bioinformatics Tool for ZNF23 Partial Recombinant Protein (H00007571-Q01)

Discover related pathways, diseases and genes to ZNF23 Partial Recombinant Protein (H00007571-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF23 Partial Recombinant Protein (H00007571-Q01)

Discover more about diseases related to ZNF23 Partial Recombinant Protein (H00007571-Q01).
 

Pathways for ZNF23 Partial Recombinant Protein (H00007571-Q01)

View related products by pathway.

Blogs on ZNF23

There are no specific blogs for ZNF23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nox4 Antibody
NB110-58849
Bcl-xL Antibody
NB100-56104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF23 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF23