ZNF224 Antibody (2C12)

Images

 
Sandwich ELISA: ZNF224 Antibody (2C12) [H00007767-M01] - Detection limit for recombinant GST tagged ZNF224 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF224 Antibody (2C12) Summary

Immunogen
ZNF224 (NP_037530.1, 95 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HQEWSFQQIWEKIASDLTRSQDLVINSSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISA
Specificity
ZNF224 - zinc finger protein 224 (2C12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF224
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF224 Antibody (2C12)

  • MGC30006
  • zinc finger protein 511

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
H00113835-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00010172-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009534-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00056242-Q01
Species: Hu
NBP1-32382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13552
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81758
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13557
Species: Hu
Applications: IHC, IHC-P
NBP1-81347
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007576-P01
Species: Hu
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
PP-H7431-00
Species: Hu
Applications: WB
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13566
Species: Hu
Applications: WB, IHC, IHC-P
H00007767-M01
Species: Hu
Applications: WB, ELISA

Publications for ZNF224 Antibody (H00007767-M01) (0)

There are no publications for ZNF224 Antibody (H00007767-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF224 Antibody (H00007767-M01) (0)

There are no reviews for ZNF224 Antibody (H00007767-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF224 Antibody (H00007767-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF224 Products

Bioinformatics Tool for ZNF224 Antibody (H00007767-M01)

Discover related pathways, diseases and genes to ZNF224 Antibody (H00007767-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF224 Antibody (H00007767-M01)

Discover more about diseases related to ZNF224 Antibody (H00007767-M01).
 

Pathways for ZNF224 Antibody (H00007767-M01)

View related products by pathway.

PTMs for ZNF224 Antibody (H00007767-M01)

Learn more about PTMs related to ZNF224 Antibody (H00007767-M01).

Blogs on ZNF224

There are no specific blogs for ZNF224, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF224 Antibody (2C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF224
Entrez
Uniprot