ZNF212 Antibody

Images

 
Western Blot: ZNF212 Antibody [NBP2-13559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: ZNF212 Antibody [NBP2-13559] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: ZNF212 Antibody [NBP2-13559] - Staining of human liver shows moderate cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF212 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLR SFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF212
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF212 Protein (NBP2-13559PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF212 Antibody

  • C2H2-150
  • zinc finger protein 212
  • Zinc finger protein C2H2-150
  • ZNF182
  • ZNFC150MGC9707

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-80968
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-46703
Species: Hu
Applications: IHC, IHC-P
NB100-2318
Species: Hu
Applications: WB, IP
NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-10680
Species: Hu
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3499
Species: Hu
Applications: WB

Publications for ZNF212 Antibody (NBP2-13559) (0)

There are no publications for ZNF212 Antibody (NBP2-13559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF212 Antibody (NBP2-13559) (0)

There are no reviews for ZNF212 Antibody (NBP2-13559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF212 Antibody (NBP2-13559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF212 Products

Bioinformatics Tool for ZNF212 Antibody (NBP2-13559)

Discover related pathways, diseases and genes to ZNF212 Antibody (NBP2-13559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF212 Antibody (NBP2-13559)

Discover more about diseases related to ZNF212 Antibody (NBP2-13559).

Blogs on ZNF212

There are no specific blogs for ZNF212, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF212 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF212