Recombinant Human ZNF154 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF154 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 35796 of Human ZNF154 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVATLRTPTQGTVTFEDVAVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDF

Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF154

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF154 Protein

  • KIAA2003
  • MGC176628
  • MGC176661
  • pHZ-92
  • zinc finger protein 154

Background

ZNF154 - zinc finger protein 154 (pHZ-92)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-90646
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-56958
Species: Hu
Applications: ICC/IF
NB200-142
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-86699
Species: Hu
Applications: IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84170
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6539
Species: Hu
Applications: WB, IHC
H00007710-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF154 Partial Recombinant Protein (H00007710-Q01) (0)

There are no publications for ZNF154 Partial Recombinant Protein (H00007710-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF154 Partial Recombinant Protein (H00007710-Q01) (0)

There are no reviews for ZNF154 Partial Recombinant Protein (H00007710-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF154 Partial Recombinant Protein (H00007710-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF154 Products

Bioinformatics Tool for ZNF154 Partial Recombinant Protein (H00007710-Q01)

Discover related pathways, diseases and genes to ZNF154 Partial Recombinant Protein (H00007710-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF154 Partial Recombinant Protein (H00007710-Q01)

Discover more about diseases related to ZNF154 Partial Recombinant Protein (H00007710-Q01).
 

Pathways for ZNF154 Partial Recombinant Protein (H00007710-Q01)

View related products by pathway.

PTMs for ZNF154 Partial Recombinant Protein (H00007710-Q01)

Learn more about PTMs related to ZNF154 Partial Recombinant Protein (H00007710-Q01).

Blogs on ZNF154

There are no specific blogs for ZNF154, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF154 Antibody
NBP1-79273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF154 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF154