ZNF124 Antibody (4G4)

Images

 
Western Blot: ZNF124 Antibody (4G4) [H00007678-M01] - Analysis of ZNF124 expression in transfected 293T cell line by ZNF124 monoclonal antibody (M01), clone 4G4.Lane 1: ZNF124 transfected lysate(33.3 KDa).Lane 2: ...read more
Western Blot: ZNF124 Antibody (4G4) [H00007678-M01] - ZNF124 monoclonal antibody (M01), clone 4G4. Western Blot analysis of ZNF124 expression in Raw 264.7.
ELISA: ZNF124 Antibody (4G4) [H00007678-M01] - Detection limit for recombinant GST tagged ZNF124 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF124 Antibody (4G4) Summary

Immunogen
ZNF124 (NP_003422, 121 a.a. - 229 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CGKAFSRSSHLRDHERTHTGEKPYECKHCGKAFRYSNCLHYHERTHTGEKPYVCMECGKAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKHEKTHIAQKPYV
Specificity
ZNF124 (4G4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF124
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF124 Antibody (4G4)

  • HZF16
  • HZF-16
  • MGC117046
  • zinc finger protein 124 (HZF-16)
  • zinc finger protein 124
  • Zinc finger protein HZF-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007695-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-79358
Species: Hu
Applications: WB
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-80599
Species: Hu
Applications: IHC, IHC-P
NB100-2134
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-91886
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007678-M01
Species: Hu
Applications: WB, ELISA

Publications for ZNF124 Antibody (H00007678-M01) (0)

There are no publications for ZNF124 Antibody (H00007678-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF124 Antibody (H00007678-M01) (0)

There are no reviews for ZNF124 Antibody (H00007678-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF124 Antibody (H00007678-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF124 Products

Bioinformatics Tool for ZNF124 Antibody (H00007678-M01)

Discover related pathways, diseases and genes to ZNF124 Antibody (H00007678-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF124 Antibody (H00007678-M01)

Discover more about diseases related to ZNF124 Antibody (H00007678-M01).
 

Pathways for ZNF124 Antibody (H00007678-M01)

View related products by pathway.

Blogs on ZNF124

There are no specific blogs for ZNF124, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF124 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF124
Entrez
OMIM
Uniprot