EFCAB2 Antibody

Images

 
Western Blot: EFCAB2 Antibody [NBP1-81219] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: EFCAB2 Antibody [NBP1-81219] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

EFCAB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFCAB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
EFCAB2 Protein (NBP1-81219PEP)

Alternate Names for EFCAB2 Antibody

  • EF-hand calcium binding domain 2
  • EF-hand calcium-binding domain-containing protein 2
  • FLJ33608
  • MGC12458

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2134
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-81634
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91886
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1298
Species: Hu, Mu, Rt
Applications: WB
NBP1-81219
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EFCAB2 Antibody (NBP1-81219) (0)

There are no publications for EFCAB2 Antibody (NBP1-81219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFCAB2 Antibody (NBP1-81219) (0)

There are no reviews for EFCAB2 Antibody (NBP1-81219). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFCAB2 Antibody (NBP1-81219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFCAB2 Antibody Products

Related Products by Gene

Bioinformatics Tool for EFCAB2 Antibody (NBP1-81219)

Discover related pathways, diseases and genes to EFCAB2 Antibody (NBP1-81219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFCAB2 Antibody (NBP1-81219)

Discover more about diseases related to EFCAB2 Antibody (NBP1-81219).
 

Pathways for EFCAB2 Antibody (NBP1-81219)

View related products by pathway.

Blogs on EFCAB2

There are no specific blogs for EFCAB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol EFCAB2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81219 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought