ZMAT4 Antibody (7H3-1C11)

Images

 
Western Blot: ZMAT4 Antibody (7H3-1C11) [H00079698-M01] - Analysis of ZMAT4 expression in transfected 293T cell line by ZMAT4 monoclonal antibody (M01), clone 7H3-1C11.Lane 1: ZMAT4 transfected lysate(17 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7H3-1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZMAT4 Antibody (7H3-1C11) Summary

Immunogen
ZMAT4 (AAH19598, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK
Specificity
ZMAT4 - zinc finger, matrin type 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZMAT4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZMAT4 Antibody (7H3-1C11)

  • FLJ13842
  • zinc finger matrin-type protein 4
  • zinc finger, matrin type 4
  • zinc finger, matrin-type 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-31234
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6989
Species: Mu
Applications: IHC
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-03396
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12306
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NLS932
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
H00079698-M01
Species: Hu
Applications: WB, ELISA

Publications for ZMAT4 Antibody (H00079698-M01) (0)

There are no publications for ZMAT4 Antibody (H00079698-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMAT4 Antibody (H00079698-M01) (0)

There are no reviews for ZMAT4 Antibody (H00079698-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMAT4 Antibody (H00079698-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZMAT4 Products

Bioinformatics Tool for ZMAT4 Antibody (H00079698-M01)

Discover related pathways, diseases and genes to ZMAT4 Antibody (H00079698-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZMAT4 Antibody (H00079698-M01)

Discover more about diseases related to ZMAT4 Antibody (H00079698-M01).

Blogs on ZMAT4

There are no specific blogs for ZMAT4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZMAT4 Antibody (7H3-1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMAT4
Entrez
Uniprot