Recombinant Human ZDHHC8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZDHHC8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 42 of Human ZDHHC8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZDHHC8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
30.36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZDHHC8 Protein

  • DHHC8
  • EC 2.3.1
  • EC 2.3.1.-
  • KIAA1292DHHC-8
  • membrane-associated DHHC8 zinc finger protein
  • probable palmitoyltransferase ZDHHC8
  • ZDHHCL1
  • Zinc finger DHHC domain-containing protein 8
  • Zinc finger protein 378
  • zinc finger, DHHC-type containing 8
  • ZNF378zinc finger, DHHC domain like containing 1

Background

ZDHHC8( AAH09442, 1 a.a. - 43 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-46015
Species: Hu
Applications: WB, Flow, IHC, IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-81376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085329-T01
Species: Hu
H00029801-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZDHHC8 Recombinant Protein (H00029801-P01) (0)

There are no publications for ZDHHC8 Recombinant Protein (H00029801-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC8 Recombinant Protein (H00029801-P01) (0)

There are no reviews for ZDHHC8 Recombinant Protein (H00029801-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC8 Recombinant Protein (H00029801-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZDHHC8 Products

Bioinformatics Tool for ZDHHC8 Recombinant Protein (H00029801-P01)

Discover related pathways, diseases and genes to ZDHHC8 Recombinant Protein (H00029801-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC8 Recombinant Protein (H00029801-P01)

Discover more about diseases related to ZDHHC8 Recombinant Protein (H00029801-P01).
 

Pathways for ZDHHC8 Recombinant Protein (H00029801-P01)

View related products by pathway.

PTMs for ZDHHC8 Recombinant Protein (H00029801-P01)

Learn more about PTMs related to ZDHHC8 Recombinant Protein (H00029801-P01).

Blogs on ZDHHC8

There are no specific blogs for ZDHHC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
ZDHHC8 Antibody
NBP1-81418

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZDHHC8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC8