ZDHHC1 Antibody

Images

 
Immunohistochemistry-Paraffin: ZDHHC1 Antibody [NBP2-13540] Staining of human liver shows strong cytoplasmic positivity in bile ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZDHHC1 Protein (NBP2-13540PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC1 Antibody

  • C16orf1
  • DHHC domain-containing cysteine-rich protein 1
  • DHHC-1
  • DHHC-domain-containing cysteine-rich protein
  • EC 2.3.1.-
  • HSU90653
  • probable palmitoyltransferase ZDHHC1
  • Zinc finger DHHC domain-containing protein 1
  • Zinc finger protein 377
  • zinc finger, DHHC domain containing 1
  • zinc finger, DHHC-type containing 1
  • ZNF377chromosome 16 open reading frame 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
AF4559
Species: Hu
Applications: WB
NB600-637
Species: Hu, Mu, Rt, Ge
Applications: WB, ELISA, IHC, IHC-P
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82781
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
AF921
Species: Hu
Applications: WB, IHC
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-57200
Species: Hu
Applications: ICC/IF
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-15140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZDHHC1 Antibody (NBP2-13540) (0)

There are no publications for ZDHHC1 Antibody (NBP2-13540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC1 Antibody (NBP2-13540) (0)

There are no reviews for ZDHHC1 Antibody (NBP2-13540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZDHHC1 Antibody (NBP2-13540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC1 Products

Bioinformatics Tool for ZDHHC1 Antibody (NBP2-13540)

Discover related pathways, diseases and genes to ZDHHC1 Antibody (NBP2-13540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC1 Antibody (NBP2-13540)

Discover more about diseases related to ZDHHC1 Antibody (NBP2-13540).
 

Pathways for ZDHHC1 Antibody (NBP2-13540)

View related products by pathway.

Blogs on ZDHHC1

There are no specific blogs for ZDHHC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC1