Recombinant Human YPEL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human YPEL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-201 of Human YPEL3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQPEASSLSQNRDASGPRRGCWLWERREQPSVTERVPTALGVPRMCVAQVLTAHLLPPRQALGSLCSPWAAPRVGPLPPAPAMVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

Protein/Peptide Type
Recombinant Protein
Gene
YPEL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human YPEL3 Protein

  • FKSG5
  • MGC10500
  • protein yippee-like 3
  • yippee-like 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-556
Species: Hu
Applications: WB, IP
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
H00083719-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for YPEL3 Recombinant Protein (H00083719-P01) (0)

There are no publications for YPEL3 Recombinant Protein (H00083719-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YPEL3 Recombinant Protein (H00083719-P01) (0)

There are no reviews for YPEL3 Recombinant Protein (H00083719-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YPEL3 Recombinant Protein (H00083719-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional YPEL3 Products

YPEL3 H00083719-P01

Bioinformatics Tool for YPEL3 Recombinant Protein (H00083719-P01)

Discover related pathways, diseases and genes to YPEL3 Recombinant Protein (H00083719-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YPEL3 Recombinant Protein (H00083719-P01)

Discover more about diseases related to YPEL3 Recombinant Protein (H00083719-P01).
 

Pathways for YPEL3 Recombinant Protein (H00083719-P01)

View related products by pathway.

PTMs for YPEL3 Recombinant Protein (H00083719-P01)

Learn more about PTMs related to YPEL3 Recombinant Protein (H00083719-P01).

Blogs on YPEL3

There are no specific blogs for YPEL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

YPEL3 Antibody
NBP1-81237

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human YPEL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YPEL3