WW domain binding protein 5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WW domain binding protein 5 Antibody [NBP1-84208] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and WBP5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414074).

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WW domain binding protein 5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCEAL9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WW domain binding protein 5 Protein (NBP1-84208PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WW domain binding protein 5 Antibody - BSA Free

• DKFZp313K1940
• N4
• NDFIP1
• pp21 homolog
• TCEAL9
• WBP-5
• WW domain binding protein 1
• WW domain binding protein 5
• WW domain-binding protein 5

Background

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCEAL9