WDR58 Antibody (1F6)

Images

 
Western Blot: WDR58 Antibody (1F6) [H00079228-M01] - WDR58 monoclonal antibody (M01), clone 1F6 Analysis of WDR58 expression in A-431.
Immunohistochemistry-Paraffin: WDR58 Antibody (1F6) [H00079228-M01] - Analysis of monoclonal antibody to WDR58 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: WDR58 Antibody (1F6) [H00079228-M01] - WDR58 monoclonal antibody (M01), clone 1F6. Analysis of WDR58 expression in PC-12.
Western Blot: WDR58 Antibody (1F6) [H00079228-M01] - Analysis of THOC6 expression in transfected 293T cell line by THOC6 monoclonal antibody (M01), clone 1F6.Lane 1: THOC6 transfected lysate (Predicted MW: 37.5 ...read more
Sandwich ELISA: WDR58 Antibody (1F6) [H00079228-M01] - Detection limit for recombinant GST tagged WDR58 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WDR58 Antibody (1F6) Summary

Immunogen
WDR58 (NP_077315, 71 a.a. ~ 181 a.a) partial recombinant protein with GST tag.TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKE LWRRQPPYRTSLEVPEINALLLVPKENSLILAGGDCQLHTMD LETGTFTRVLRGHTDYIHCLALRERS
Specificity
WDR58 - WD repeat domain 58
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
THOC6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00079228-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WDR58 Antibody (1F6)

  • fSAP35WDR58
  • Functional spliceosome-associated protein 35
  • MGC2655
  • THO complex 6 homolog (Drosophila)
  • THO complex subunit 6 homolog
  • WD repeat domain 58
  • WD repeat-containing protein 58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82076
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33286
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19160
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-92500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-92502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-174
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ChIP, ICC/IF, IHC, IP
H00003213-Q01
Species: Hu
NBP2-58594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR58 Antibody (H00079228-M01)(2)

Reviews for WDR58 Antibody (H00079228-M01) (0)

There are no reviews for WDR58 Antibody (H00079228-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR58 Antibody (H00079228-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for WDR58 Antibody (H00079228-M01)

Discover related pathways, diseases and genes to WDR58 Antibody (H00079228-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for WDR58 Antibody (H00079228-M01)

View related products by pathway.

Research Areas for WDR58 Antibody (H00079228-M01)

Find related products by research area.

Blogs on WDR58

There are no specific blogs for WDR58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR58 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol THOC6
Entrez
Uniprot