We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WDR4 Recombinant Protein Antigen

Images

 
There are currently no images for WDR4 Protein (NBP1-86901PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WDR4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR4.

Source: E. coli

Amino Acid Sequence: AGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSNSGSYFALTDDSKRLILFRTKPWQCLSVRTVAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WDR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86901.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR4 Recombinant Protein Antigen

  • tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
  • WD repeat domain 4, 10TRM82
  • WD repeat-containing protein 4

Background

WDR4 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88386
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85622
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB79671
Applications: ICC, Simple Western, WB
AF887
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, In vitro, In vivo, Simple Western, WB
NBP2-52555
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-00641
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-54897
Species: Hu
Applications: IHC,  IHC-P
MAB864
Applications: ICC, Simple Western, WB
NBP1-33518
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
NBP2-19853
Species: Hu
Applications: ChIP, ICC/IF, IP, WB

Publications for WDR4 Protein (NBP1-86901PEP) (0)

There are no publications for WDR4 Protein (NBP1-86901PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR4 Protein (NBP1-86901PEP) (0)

There are no reviews for WDR4 Protein (NBP1-86901PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDR4 Protein (NBP1-86901PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR4 Products

Blogs on WDR4

There are no specific blogs for WDR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR4