WBP11 Recombinant Protein Antigen

Images

 
There are currently no images for WBP11 Recombinant Protein Antigen (NBP2-58142PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WBP11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to WBP11.

Source: E. coli

Amino Acid Sequence: DIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WBP11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58142.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WBP11 Recombinant Protein Antigen

  • DKFZp779M1063
  • Npw38-binding protein NpwBP
  • Npw38-binding protein
  • NpwBP
  • NPWBPsplicing factor, PQBP1 and PP1 interacting
  • SH3 domain-binding protein SNP70
  • SIPP1WW domain-binding protein 11
  • SNP70
  • Splicing factor that interacts with PQBP-1 and PP1
  • WBP-11
  • WW domain binding protein 11

Background

WBP11 encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82619
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-84718
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Single-Cell Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16020
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4569
Species: Hu, Mu, Rt
Applications: ICC, IP, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for WBP11 Recombinant Protein Antigen (NBP2-58142PEP) (0)

There are no publications for WBP11 Recombinant Protein Antigen (NBP2-58142PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBP11 Recombinant Protein Antigen (NBP2-58142PEP) (0)

There are no reviews for WBP11 Recombinant Protein Antigen (NBP2-58142PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WBP11 Recombinant Protein Antigen (NBP2-58142PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WBP11 Products

Array NBP2-58142PEP

Research Areas for WBP11 Recombinant Protein Antigen (NBP2-58142PEP)

Find related products by research area.

Blogs on WBP11

There are no specific blogs for WBP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WBP11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WBP11