VSIG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81074] - Staining in human stomach and liver tissues using anti-VSIG1 antibody. Corresponding VSIG1 RNA-seq data are presented for the same tissues.

Western Blot: VSIG1 Antibody [NBP1-81074] - Analysis in control (vector only transfected HEK293T lysate) and vSIG1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81074] - Staining of human liver shows low expression as expected.

Western Blot: VSIG1 Antibody [NBP1-81074] - Analysis in denatured VSIG1 overexpression lysate (Cat. # H00340547-T01, left), vector only transfected lysate (center) and native VSIG1 overexpression lysate (Cat. # NBL1-17761, right). Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81074] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VSIG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VSIG1 Antibody - BSA Free (NBP1-81074) is a polyclonal antibody validated for use in IHC and WB. Anti-VSIG1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSIG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  VSIG1 Protein (NBP1-81074PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VSIG1 Antibody - BSA Free

• Cell surface A33 antigen
• dJ889N15.1
• Glycoprotein A34
• GPA34
• MGC44287,1700062D20Rik
• V-set and immunoglobulin domain containing 1
• V-set and immunoglobulin domain-containing protein 1
• VSIG1

Background

The VSIG1 gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multipleglycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP)repeats at the C-terminal regi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VSIG1 Antibody (NBP1-81074)(1)

Publication using NBP1-81074

• Kim JH, Kim KJ, Rhee YY et al. Gastric-type expression signature in serrated pathway-associated colorectal tumors. Hum Pathol 2015-05-01 [PMID: 25704805] (Human)

Reviews for VSIG1 Antibody (NBP1-81074) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Both human and mouse tissue.

reviewed by: Jennifer Cotton IHC-P Both human and mouse tissue 12/08/2016

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Paraffin sections of human and mouse intestine
• Species: Both human and mouse tissue
• Lot: N/A

reviewed by: Ming Lu WB Human 09/26/2014

Summary

• Application: Western Blot
• Sample Tested: VSIG1 overepxression lysate
• Species: Human
• Lot: A95938

Bioinformatics

• Gene Symbol: VSIG1
• Entrez:
  • 340547(Human)
• Uniprot:
  • Q86XK7()
  • Q86XK7()
  • Q86XK7()
  • Q86XK7()